Nama-nama terpanjang

25 Mei 2016 - Payment System Terbaru Untuk Bursa Jual Beli telah kami hadirkan.
Untuk informasi lebih lengkap dapat dilihat di http://modifika.si/630917

Page 1 of 4 1234 LastLast
Results 1 to 10 of 31
  • Thread Tools
  • Short URL:  http://modifika.si/45180
  • Share on facebook
  • Share on twitter
  1. #1
    Letnan Kolonel
    Location
    jakarta yg penuh polusi
    Posts
    6,307
    Power
    78 
    M-Store Point
    0
    Online
    3 Wks 11 Hrs 10 Mins 40 Secs

    Nama-nama terpanjang

    Ngutip dari blog nya orang
    berikut ini adalah nama2 panjang yang dibuat orang mulai dari kota, email Dll.

    bikin susah aja yah?.. apa ga mending singkat n jelas

    Nama - Nama Terpanjang

    1. Nama Desa Terpanjang

    Llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogoch
    ialah sebuah desa di pulau Anglesey di Wales, Britania Raya. Desa ini tercatat dalam Guiness Book of Record sebagai tempat yang namanya terpanjang di Britania.

    2. Nama Orang Terpanjang

    Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown
    ke 27 kata itu adalah nama seorang anak di Inggris. Namanya diambil dari 25 nama petinju top dari seluruh dunia. Sisa 2 adalah nama depan dan nama keluarga. Wuih, pasti papa nya penggemar tinju yah

    3. Nama Bukit Terpanjang

    Taumatawhakatangihangakoauauotamateaturipukakapiki maungahoronukupokaiwhenuakitanatahu
    adalah nama sebuah bukit di Porangahau, di selatan Waipukurau di selatan Hawke's Bay, Selandia Baru. Nama ini biasanya disingkat jadi Taumata. Trus buat apa panjang2

    4. Nama Domain dan Nama Kota Terpanjang

    Code:

    http://www.llanfairpwllgwyngyllgoger...ogogoch.co.uk/

    merupakan situs untuk mempromosikan sebuah kota di Anglesey, Gwynedd, Inggris. Nama kotanya sama kayak nama situsnya..

    5. Nama Album Terpanjang

    he Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty
    adalah nama sebuah album yang dirilis oleh mantan penyanyi Sin Ad O'Connor

    6. Nama E-Mail Terpanjang

    Code:

    yourname@abcdefghijklmnopqrstuvwxyza...bcdefghijk.com

    nama yang sangat panjang untuk sebuah email address
    cara daftarnya, masuk aja ke web nya di
    Code:

    http://www.abcdefghijklmnopqrstuvwxy...cdefghijk.com/

    7. Nama Tempat Terpanjang

    Krungthepmahanakonbowornratanakosinmahintarayudyay amahadiloponoparatanarajthaniburiromudomrajniwes hasatarnamornpimarnavatarsatitsakattiyavisanukamph rasit
    nama tempat di Thailand. Ga tau nama tempat apa hehe..

    8. Nama Perkumpulan Terpanjang (di Indonesia)

    IKNNYPNITDI
    Ikatan Komikus Nggak Nyambung Yang Punya Nama Ikatan Terpanjang Di Indonesia.
    haha.. Aneh banget namanya yah..
    gw dapet dari situs DeviantArt, disitu ada yang pake signature kayak gitu.. hehe..

    Sebenernya masih banyak lagi yang Panjang2..
    Tapi takutnya ntar Kepanjangan

    ----------------------------------------------------------------------------------------------------
    kalau berkenan cendolnya ya...thx

  2. Bandargua
  3. #2
    Kapten
    Location
    Bandung
    Posts
    2,307
    Power
    31 
    M-Store Point
    0
    Online
    43 Mins 22 Secs
    Quote Originally Posted by sleepyeyes View Post
    Ngutip dari blog nya orang
    berikut ini adalah nama2 panjang yang dibuat orang mulai dari kota, email Dll.

    bikin susah aja yah?.. apa ga mending singkat n jelas

    Nama - Nama Terpanjang

    1. Nama Desa Terpanjang

    Llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogoch
    ialah sebuah desa di pulau Anglesey di Wales, Britania Raya. Desa ini tercatat dalam Guiness Book of Record sebagai tempat yang namanya terpanjang di Britania.

    2. Nama Orang Terpanjang

    Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown
    ke 27 kata itu adalah nama seorang anak di Inggris. Namanya diambil dari 25 nama petinju top dari seluruh dunia. Sisa 2 adalah nama depan dan nama keluarga. Wuih, pasti papa nya penggemar tinju yah

    3. Nama Bukit Terpanjang

    Taumatawhakatangihangakoauauotamateaturipukakapiki maungahoronukupokaiwhenuakitanatahu
    adalah nama sebuah bukit di Porangahau, di selatan Waipukurau di selatan Hawke's Bay, Selandia Baru. Nama ini biasanya disingkat jadi Taumata. Trus buat apa panjang2

    4. Nama Domain dan Nama Kota Terpanjang

    Code:

    http://www.llanfairpwllgwyngyllgoger...ogogoch.co.uk/

    merupakan situs untuk mempromosikan sebuah kota di Anglesey, Gwynedd, Inggris. Nama kotanya sama kayak nama situsnya..

    5. Nama Album Terpanjang

    he Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty
    adalah nama sebuah album yang dirilis oleh mantan penyanyi Sin Ad O'Connor

    6. Nama E-Mail Terpanjang

    Code:

    yourname@abcdefghijklmnopqrstuvwxyza...bcdefghijk.com

    nama yang sangat panjang untuk sebuah email address
    cara daftarnya, masuk aja ke web nya di
    Code:

    http://www.abcdefghijklmnopqrstuvwxy...cdefghijk.com/

    7. Nama Tempat Terpanjang

    Krungthepmahanakonbowornratanakosinmahintarayudyay amahadiloponoparatanarajthaniburiromudomrajniwes hasatarnamornpimarnavatarsatitsakattiyavisanukamph rasit
    nama tempat di Thailand. Ga tau nama tempat apa hehe..

    8. Nama Perkumpulan Terpanjang (di Indonesia)

    IKNNYPNITDI
    Ikatan Komikus Nggak Nyambung Yang Punya Nama Ikatan Terpanjang Di Indonesia.
    haha.. Aneh banget namanya yah..
    gw dapet dari situs DeviantArt, disitu ada yang pake signature kayak gitu.. hehe..

    Sebenernya masih banyak lagi yang Panjang2..
    Tapi takutnya ntar Kepanjangan

    ----------------------------------------------------------------------------------------------------
    kalau berkenan cendolnya ya...thx
    kota apaan tuh... trus itu komikus koq aneh banget sih kelakuannya... hihihi.. nice post brur..

  4. #3
    Brigadir Jendral
    Posts
    12,375
    Power
    55 
    M-Store Point
    0
    Online
    3 Hrs 35 Mins 11 Secs
    klo t*t*t terpanjang punya sapa hayooooooooo.........

  5. #4
    Letnan Kolonel
    Location
    jakarta yg penuh polusi
    Posts
    6,307
    Power
    78 
    M-Store Point
    0
    Online
    3 Wks 11 Hrs 10 Mins 40 Secs
    Quote Originally Posted by bayuaji View Post
    klo t*t*t terpanjang punya sapa hayooooooooo.........
    punya........siapa ya?????

  6. #5
    Brigadir Jendral
    Posts
    12,375
    Power
    55 
    M-Store Point
    0
    Online
    3 Hrs 35 Mins 11 Secs
    Quote Originally Posted by sleepyeyes View Post
    punya........siapa ya?????
    mick jagger.....

  7. #6
    Letnan Kolonel
    Location
    jakarta yg penuh polusi
    Posts
    6,307
    Power
    78 
    M-Store Point
    0
    Online
    3 Wks 11 Hrs 10 Mins 40 Secs
    Quote Originally Posted by bayuaji View Post
    mick jagger.....
    masa sihhh???? dah pernah liat?

  8. #7
    Brigadir Jendral
    Location
    Jakarta Bogor Bandung
    Posts
    10,763
    Power
    69 
    M-Store Point
    0
    Online
    1 Day 20 Hrs 59 Mins 13 Secs
    itu bacanya gimana ya yang nama kota..
    huahahaha
    if you have everything under control, then you don't drive fast enough

  9. #8
    Brigadir Jendral
    Posts
    12,375
    Power
    55 
    M-Store Point
    0
    Online
    3 Hrs 35 Mins 11 Secs
    Quote Originally Posted by sleepyeyes View Post
    masa sihhh???? dah pernah liat?
    liat pidio konsernya hihihihihihihihihi tuh otong nongol ampe ke puser

    wakakakakakakakakakakakakakakak..
    parah tuh aki2..

  10. #9
    Kapten
    Location
    kolong mobil
    Posts
    2,335
    Power
    23 
    M-Store Point
    0
    Online
    1 Day 36 Mins 36 Secs
    mambahin dikit ya.

    nama mobil terpanjang

    mitsubishi LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLL

    orang biasa nyebut mitsubishi L300..

  11. #10
    Sersan Kepala
    Location
    Camp My Your Own
    Posts
    567
    Power
    30 
    M-Store Point
    0
    Online
    3 Mins 28 Secs
    Quote Originally Posted by tri1328 View Post
    mambahin dikit ya.

    nama mobil terpanjang

    mitsubishi LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLL

    orang biasa nyebut mitsubishi L300..
    hehehehe...

    ada2 aja nih..

 

 
Page 1 of 4 1234 LastLast
Vkool Venom 300x250

Thread Information

Users Browsing this Thread

There are currently 1 users browsing this thread. (0 members and 1 guests)

Similar Threads

  1. [ASK]Balik nama dari PRIBADI ke atas nama perusahaan.. BUKAN sebaliknya..
    By 112Ben in forum Diskusi Otomotif Lain-Lainnya
    Replies: 5
    Last Post: 19th August 2013, 18:08
  2. Replies: 22
    Last Post: 9th August 2012, 12:08
  3. Replies: 80
    Last Post: 24th April 2012, 07:35
  4. BOS NAMA VELG INI APA YAH??
    By B1991HW in forum Diskusi Kaki-Kaki
    Replies: 21
    Last Post: 31st October 2008, 17:49
Back to top